High Quality Floating Fish Feed Pellet for Catfish
Delivery term:The date of payment from buyers deliver within days- Price:
Negotiable
- minimum:
- Total supply:
- Delivery term:
The date of payment from buyers deliver within days
- seat:
Beijing
- Validity to:
Long-term effective
- Last update:
2017-12-23 10:44
- Browse the number:
119
Company Profile
- Jinhua Weihai Plexiglass Product Co. Ltd By certification [File Integrity]
-
Contact:
yataifeed(Ms.)
- Telephone:
-
Area:
Beijing
-
Address:
Building 4, Jindong Lipu Town, Jinhua City, Yiwu, Zhejiang, China (322000)
- Website: http://yataifeed.gdrftx.com/
Product details
Model Number: animal feed
Brand Name: yatai
Key Specifications/Special Features:
Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitativeandqualitative"andaccordingtotheweather,watertemperature,waterqualityandfeedingadjustfeedingamount,avoidfeedcausestoomuchwaste.Watertemperatureduring20cto30c:3-4times/day;below20c:1-2times/day;Feedrate:3-5%fishweightforstart;1-2%fishweightforgrower;3.Cleartheleftfeedintimetoavoidpollutionwater.Specification;
protein :28% Min
Moisture; 10% Max
Ash: 12% Max
Fat: 4% Min
Size; 1mm---8mm
Storage
Stored in a cool, ventilated and dry place
Shelf life: 12 month
protein :28% Min
Moisture; 10% Max
Ash: 12% Max
Fat: 4% Min
Size; 1mm---8mm
Storage
Stored in a cool, ventilated and dry place
Shelf life: 12 month
Shipping Information:
- FOB Port: qingdao
- Lead Time: 15 - 20 days
- Dimensions per Unit: 0.8 × 0.5 × 0.8 Meters
- Weight per Unit: 25.1 Kilograms
- Units per Export Carton: 15
- Export Carton Dimensions L/W/H: 5.8 × 2.3 × 2.3 Meters
- Export Carton Weight: 15 Tons (US)
Main Export Markets:
- Asia
- Australasia
- Central/South America
- Eastern Europe
- Mid East/Africa
- North America
- Western Europe
New Products
-
Three-piece Square Cake Box
price: Negotiable
-
Dying Over Patterned Fabric
price: Negotiable
-
Square One-piece Paper Cake Box
price: Negotiable
-
2 LED Forklift Blue Light
price: Negotiable
-
Durable Metal Free Standing Pegboard Rack
price: Negotiable
-
2BV2 Liquid Ring Vacuum Pump
price: Negotiable